What's new:

(new) PPSP has been updated to version 1.06, now multiple sequences (in FASTA format) can be submitted at one time

A breif introduction to PPSP:

As a reversible and dynamic post-translational modification of proteins, phosphorylation plays an essential regulatory role in a broad spectrum of the biological cellular processes. Conventional experimental identifications of protein kinase (PK)-specific phosphorylation sites on substrates in vivo and in vitro have provided the foundation of understanding the mechanisms of phosphorylation dynamics. However, these experiments are often time-consuming and expensive. And the enzymatic activity of the PKs are usually diminished or impeded in vitro, hampering on the studies of phosphorylation greatly. With regard of this, it is of note that the in silico prediction of PK-specific phosphorylation sites is urgent need for the further experimental manipulation. In this work, we presented a novel, versatile and comprehensive program, PPSP (Prediction of PK-specific Phosphorylation site), deployed with approach of Bayesian decision theory.

With the unambiguous experimental verified training data set, PPSP could predict the bona fide phosphorylation sites accurately for 68 PK groups.

How to use PPSP:

Acceptable data formats: plain text or FASTA.

If you submit a protein with plain text format, please make sure that the data contains only characters. A example of plain text format data:

SETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVV
INCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPP
PALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPG
PPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQ
EEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPA
QSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQK
VKEEIIEAFVQELRKRGSP

If you submit a protein with FASTA format, please make sure that the data contains two parts: A title line, which must begin with a `>' symbol. and the sequence itself, which begin with a new line. A example of FASTA format data:

>P50552
SETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVV
INCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPP
PALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPG
PPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQ
EEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPA
QSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQK
VKEEIIEAFVQELRKRGSP

Thanks for using PPSP, if you find any errors in this page or the system, please email to:"xueyu@ustc.edu.cn".